PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009804922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 768aa    MW: 87242.2 Da    PI: 6.1973
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009804922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS373.92.1e-1143957661374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+av+++d + a +lL++++ ++sp gd +qRla++f+ +++arla+++s++ykal  ++ts    ++ l+a++l+   sP+ k+s 
  XP_009804922.1 395 LRTLLINCAQAVAADDCRSAIELLKQIRLHSSPFGDGNQRLAHCFADGMEARLAGTGSQIYKALVNKKTS---AADFLKAYHLYLASSPFRKLSG 486
                     6789************************************************************999999...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++ N++I+  + ++ rvH+iDf+i +G+QWp+L+q +++R++gpp+lRiTg++ p++g   +e++eetg+rLa++A++++vpfe+++ +ak++e+
  XP_009804922.1 487 FASNKTIMTKAGNAARVHVIDFGILYGFQWPTLIQRISAREGGPPKLRITGIEFPQPGfrPAERIEETGRRLADYAQTFNVPFEYHA-IAKKWET 580
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L+++++E l+Vn+ ++ ++l+de+v ++s r+ vL+l+++++P+++++   +  ++++ F++rf e l ++salfd+lea++pres er+
  XP_009804922.1 581 IRLEDLKLEKDEFLVVNCLYRFKNLPDETVLTDSSRTLVLDLIRKINPDIFIHGIVNGAYSAPFFVTRFREVLFHFSALFDMLEANVPRESPERM 675
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +Ere++gre+ nv+aceg er+er et+++W+ r  +a F+++p++ ++++ a   +   + + + ++e++++l+lgWk+r+++++S+W+
  XP_009804922.1 676 LIEREIFGREALNVIACEGWERVERPETYKQWQVRNLRARFTQIPFEREVMNRAIEKVTSSYHKDFVIDENNKWLLLGWKGRTIYALSCWK 766
                     ******************************************************99999999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.101369746IPR005202Transcription factor GRAS
PfamPF035147.4E-112395766IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDPRFNSFPT SMNGFSLENQ SLPISSNRWK NNEPRFEAIY QDQKLVNGPR FENNFVPNNV  60
GGVQSVSNDP LPTSSNKALT SDIGAEDEYN EDFDFSDTVL SYINQMLMEE DMEDKTHMLQ  120
ESLEFQAKEK SFYEALGKKY PPSPQQNLSI TYQNDEIPDE YCSGSLYNFT SNSNDSSGYL  180
IDPTVINISN DLDSSYVQGL SVCNGTYSSI SSSSSLNNIV DGFLDSPVSP LHTPDIYNDS  240
HPIWNFRKGV EEANKFLPTN IKLLDNVDIN DLLPLEKRGE SGYVAARVEK RYAGETSPTE  300
PRGRKNPHRD DKDLLEEERS SKQAAVYTES TVRSDEFDIV LLHSLGNGKE ALEAYRESLK  360
NARMKTTVQN GKSKGYNGGK GRGKKHSSKK EVIDLRTLLI NCAQAVAADD CRSAIELLKQ  420
IRLHSSPFGD GNQRLAHCFA DGMEARLAGT GSQIYKALVN KKTSAADFLK AYHLYLASSP  480
FRKLSGFASN KTIMTKAGNA ARVHVIDFGI LYGFQWPTLI QRISAREGGP PKLRITGIEF  540
PQPGFRPAER IEETGRRLAD YAQTFNVPFE YHAIAKKWET IRLEDLKLEK DEFLVVNCLY  600
RFKNLPDETV LTDSSRTLVL DLIRKINPDI FIHGIVNGAY SAPFFVTRFR EVLFHFSALF  660
DMLEANVPRE SPERMLIERE IFGREALNVI ACEGWERVER PETYKQWQVR NLRARFTQIP  720
FEREVMNRAI EKVTSSYHKD FVIDENNKWL LLGWKGRTIY ALSCWKPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-453997668375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804922.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK4D4840.0K4D484_SOLLC; Uncharacterized protein
STRINGSolyc10g086530.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein